RUOResearch use only
LotBatch-numbered
−20°CShipped desiccated
KLOW Blend — BPC-157 | TB-500 | GHK-Cu | KPV Peptide
Four-component blend (BPC-157, TB-500, GHK-Cu, KPV) in a single 80 mg lyophilised vial.
$150.00
In stock — ships next business day
Quick Facts
| SKU | BPL-KLOW |
|---|---|
| CAS Number | 137525-51-0 (BPC-157) · 77591-33-4 (TB-500) · 89030-95-5 (GHK-Cu) · 67247-12-5 (KPV) |
| Molecular Formula | BPC-157 C62H98N16O22 · TB-500 C212H350N56O78S · GHK-Cu C14H22CuN6O4 · KPV C16H30N4O4 |
| Molecular Weight | BPC-157 1,419.53 · TB-500 4,963.44 · GHK-Cu 403.9 (Cu complex) · KPV 342.44 g/mol |
| Sequence | BPC-157: GEPPPGKPADDAGLV | TB-500 (Tβ4 fragment): SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES | GHK-Cu: Gly-His-Lys·Cu²⁺ | KPV: Lys-Pro-Val |
| Physical Form | Lyophilized Powder |
| Storage | Store at -20°C |
Research Information
KLOW is a co-lyophilised blend of four well-characterised research peptides in one vial: BPC-157, the TB-500 thymosin β4 fragment, the copper tripeptide GHK-Cu, and the α-MSH-derived tripeptide KPV. The blend exists so a laboratory can run a combined-exposure arm without preparing and pipetting four separate stocks.
Each component brings a different pathway to the plate: BPC-157 in angiogenesis and fibroblast assays, TB-500 in actin-sequestration and cell-migration work, GHK-Cu in extracellular-matrix and copper-transport studies, and KPV in NF-κB-related inflammatory signalling models. Comparing the blend against its individual components is the standard way to test for additive or interfering effects.
Supplied as an 80 mg lyophilised total peptide mass. Reconstitute with bacteriostatic water, do not shake, and keep the reconstituted vial refrigerated and protected from light.
Supplied strictly for in-vitro laboratory research. Not for human or veterinary use, and not for food, drug, cosmetic or diagnostic application.
Each component brings a different pathway to the plate: BPC-157 in angiogenesis and fibroblast assays, TB-500 in actin-sequestration and cell-migration work, GHK-Cu in extracellular-matrix and copper-transport studies, and KPV in NF-κB-related inflammatory signalling models. Comparing the blend against its individual components is the standard way to test for additive or interfering effects.
Supplied as an 80 mg lyophilised total peptide mass. Reconstitute with bacteriostatic water, do not shake, and keep the reconstituted vial refrigerated and protected from light.
Supplied strictly for in-vitro laboratory research. Not for human or veterinary use, and not for food, drug, cosmetic or diagnostic application.
For laboratory and research use only. Not intended for human or animal consumption. All product information is derived from published preclinical research and does not constitute medical advice or claims.
Related Research Compounds
View All